Recombinant Human Mothers Against Decapentaplegic Homolog 3/SMAD3 (N-6His-Flag)
50 ug
CE17-50
304 €
Flag
Human
P84022
50,3 kDa
recombinants
Escherichia coli
Ambient/Room Temperature
Recombinants or rec. proteins
Greater than 95% as determined by reducing SDS-PAGE.
See included datasheet or contact us for more information.
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Lyophilized from a 0.2 µm filtered solution of 20mM PB,500mM NaCl, pH7.5.
Recombinant Human Mothers Against Decapentaplegic Homolog 3 is produced by our E.coli expression system and the target gene encoding Ser2-Ser425 is expressed with a 6His, Flag tag at the N-terminus.
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
MRGSHHHHHHGSDYKDDDDKSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
An anti-flag tag (FLAG fusion protein) is use to detect a FLAG-tag, or FLAG octapeptide, or FLAG epitope that is a polypeptide protein tag that can be added to a protein using recombinant DNA. This FLAG-tags have the sequence DYKDDDDK motiv. These tags are very useful to do protein purification by affinity chromatography. Also separation of recombinant, overexpressed proteins from cell lysates is done by FLAG go HIS tags. FLAGS are also used in the isolation of protein complexes with multiple subunits, because its mild purification procedure tends not to disrupt such complexes. It has been used to enrich proteins of height purity and quality to see the 3D crystal structure with x-ray. Suitable for in vivo use in cells. For electrophorese protein detection rabbit polyclonals anti Flag conjugation are the most suited antibodies.Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
© Smad Family 2010-2024. All right reserved. Designed and Developed by GrayGrids.