SMAD Antibody (SMAD1-5)
0.1mg
R32238
406 €
WB
Q15797
Antibody
anticorps
Unconjugated
SMAD (SMAD1-5)
Antigen affinity
Polyclonal antibody
Nuclear and cytoplasmic
Antigen affinity purified
Western blot: 0.1-0.5ug/ml
Polyclonal (rabbit origin)
Rabbit (Oryctolagus cuniculus)
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Optimal dilution of the SMAD antibody should be determined by the researcher.
This SMAD antibodyis to be used only for research purposes and not for diagnostics..
Amino acids QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH of human SMAD1-5 were used as the immunogen for the SMAD antibody.
If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
After reconstitution, the SMAD antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-beta superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4.
© Smad Family 2010-2025. All right reserved. Designed and Developed by GrayGrids.