Rabbit GARS antibody
50 ug
70R-2361
495 €
NA
WB
1 mg/ml
Blue Ice
anticorps
DNA & RNA
Human,Mouse,Rat
Primary Antibodies
Oryctolagus cuniculus
Purified Polyclonal Antibodies
GARS antibody was raised against the middle region of GARS
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GARS antibody in PBS
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
GARS antibody was raised using the middle region of GARS corresponding to a region with amino acids IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN
Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
© Smad Family 2010-2026. All right reserved. Designed and Developed by GrayGrids.