GARS antibody

Basic information

Name

GARS antibody

size

50 µg

Catalog number

70R-2361

Price

475 €

Extended information

Tested for

WB

Raised in

Rabbit

Concentration

1 mg/ml

Shipping conditions

Blue Ice

French translation

anticorps

Area of research

DNA & RNA

Usage Recommendations

WB: 1 ug/ml

Cross Reactivity

Human,Mouse,Rat

Category

Primary Antibody

Method of Purification

Affinity purified

Antibody Subtype

Polyclonal Antibodies, Purified

Specificity

GARS antibody was raised against the middle region of GARS

Form & Buffer

Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GARS antibody in PBS

Storage

Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Properties

If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Assay Information

GARS Blocking Peptide, catalog no. 33R-3949, is also available for use as a blocking control in assays to test for specificity of this GARS antibody

Type of Immunogen

GARS antibodies were raised using the middle region of GARS corresponding to a region with amino acids IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN

Additional Information

This is a rabbit polyclonal antibody against GARS, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com