Anti-SMAD1 Picoband Antibody
100µg/vial
PB9395
390 €
WB
N/A
anticorps
Polyclonal
Lyophilized
Human, Mouse, Rat
Immunogen affinity purified.
30ug for $99, contact us for details
No cross reactivity with other proteins.
www.bosterbio.com/datasheet.php?sku=PB9395
Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
A synthetic peptide corresponding to a sequence in the middle region of human SMAD1 (240-270aa QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH), different from the related mouse sequence by two amino acids, and from the related rat sequence by five amino acids.
© Smad Family 2010-2024. All right reserved. Designed and Developed by GrayGrids.