SMAD1 Antibody
0,1 mg
PB9395
374 €
WB
4086
SMAD1
SMAD1
rabbit
Q15797
anticorps
freeze-dried
human, mouse, rat
Polyclonal antibody
Polyclonal antibody
SMAD family member 1
IgG polyclonal antibody
Immunogen affinity purified.
Mothers against decapentaplegic homolog 1
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
BSP 1 | BSP1 | BSP-1 | BSP1 | MADH1 | MADR1 | HsMAD1 | JV4 1 | JV4-1 | MADH1 | Madh1 | Madr1 | Q15797 | SMAD1
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
1. Zhu, H., Kavsak, P., Abdollah, S., Wrana, J. L., Thomsen, G. H. A SMAD ubiquitin ligase targets the BMP pathway and affects embryonic pattern formation. Nature 400: 687-693, 1999.
The SMAD1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
A synthetic peptide corresponding to a sequence in the middle region of human SMAD1 (240-270aa QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH), different from the related mouse sequence by two amino acids, and from the related rat sequence by five amino acids.
Keep the SMAD1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-β superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4.
© Smad Family 2010-2026. All right reserved. Designed and Developed by GrayGrids.