Recombinant Human Mothers Against Decapentaplegic Homolog 3/SMAD3 (N-6His-Flag)

Basic information

Name

Recombinant Human Mothers Against Decapentaplegic Homolog 3/SMAD3 (N-6His-Flag)

size

1 mg

Catalog number

CE17-1000

Price

1674 €

Details & buy    

Extended information

Conjugation

Flag

Species reactivity

Human

UniProt number

P84022

Estimated molecular weight

50,3 kDa

Group

recombinants

Origin

Escherichia coli

Shipping condition

Ambient/Room Temperature

Source

Recombinants or rec. proteins

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Reconstitution conditions

See included datasheet or contact us for more information.

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Package form

Lyophilized from a 0.2 µm filtered solution of 20mM PB,500mM NaCl, pH7.5.

Description

Recombinant Human Mothers Against Decapentaplegic Homolog 3 is produced by our E.coli expression system and the target gene encoding Ser2-Ser425 is expressed with a 6His, Flag tag at the N-terminus.

Storage conditions

Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.

Peptide sequence

MRGSHHHHHHGSDYKDDDDKSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

Properties

An anti-flag tag (FLAG fusion protein) is use to detect a FLAG-tag, or FLAG octapeptide, or FLAG epitope that is a polypeptide protein tag that can be added to a protein using recombinant DNA. This FLAG-tags have the sequence DYKDDDDK motiv.  These tags are very useful to do protein purification by affinity chromatography. Also separation of recombinant, overexpressed proteins from cell lysates is done by FLAG go HIS tags. FLAGS are also used in the isolation of protein complexes with multiple subunits, because its mild purification procedure tends not to disrupt such complexes. It has been used to enrich proteins of height purity and quality to see the 3D crystal structure with x-ray. Suitable for in vivo use in cells. For electrophorese protein detection rabbit polyclonals anti Flag conjugation are the most suited antibodies.Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.