GARS antibody
50 µg
70R-2361
475 €
WB
Rabbit
1 mg/ml
Blue Ice
anticorps
DNA & RNA
WB: 1 ug/ml
Human,Mouse,Rat
Primary Antibody
Affinity purified
Polyclonal Antibodies, Purified
GARS antibody was raised against the middle region of GARS
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GARS antibody in PBS
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
GARS Blocking Peptide, catalog no. 33R-3949, is also available for use as a blocking control in assays to test for specificity of this GARS antibody
GARS antibodies were raised using the middle region of GARS corresponding to a region with amino acids IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN
This is a rabbit polyclonal antibody against GARS, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
© Smad Family 2010-2024. All right reserved. Designed and Developed by GrayGrids.